PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.321510.1
Common NameCsa_3G016970, LOC101215791
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SRS
Protein Properties Length: 389aa    MW: 43201.4 Da    PI: 8.9548
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.321510.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702262.7e-085084539
          DUF702  5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathv 39
                    + +C+ CGn a+  C +e C+ CC  +   C  hv
  Cucsa.321510.1 50 KPKCRVCGNVARSRCPYESCKSCCARNQNPCYIHV 84
                    568*******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.6E-55285IPR007818Protein of unknown function DUF702
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MAAPSPTLSN NSSDTATTTA GAVAANVAVS PNHLANRTGT PPKTLRGLNK PKCRVCGNVA  60
RSRCPYESCK SCCARNQNPC YIHVLKANAT FPDKTPSSSS PLFDKQSPDP SSSGTSNRVA  120
SLRQLSSNFS QFNNVRLPIR SPKPLTRKDA ATINEWRFSK LREFRERHIE AENEAFDRYM  180
KNINLLEEVF STKSMIDDRP LKDRPPVNSG TEANPEEMTP GLKLKLGSTS DNSRKRIRKI  240
VEDGLRKIKI VETIDNVDEV TDHAQADRGE DETNPNDGCK MLEGWHAKRT RALGDLIDKL  300
NKARNEEDLK SCLAMKHQLS DQHKTTSSEA ESEETDTSKE QQVIKKDLDS RKELGFSLPK  360
LVNKTNIDQQ TLNQIDAHFS SLKQIGNL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818600.0LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150175.10.0PREDICTED: uncharacterized protein LOC101215791
TrEMBLA0A0A0L2090.0A0A0A0L209_CUCSA; Uncharacterized protein
STRINGVIT_02s0012g00300.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF76901618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32730.16e-84
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]